Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of G1P3 monoclonal antibody (M02), clone M2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about G1P3 monoclonal antibody (M02), clone M2
| Product description: | Mouse monoclonal antibody raised against a full length recombinant G1P3. |
| Clone: | M2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2537 |
| Gene name: | IFI6 |
| Gene alias: | 6-16|FAM14C|G1P3|IFI-6-16|IFI616 |
| Gene description: | interferon, alpha-inducible protein 6 |
| Genbank accession: | BC011601 |
| Immunogen: | G1P3 (AAH11601, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE |
| Protein accession: | AAH11601 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Size: | 100 ug |
| Shipping condition: | Dry Ice |