No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002487-M09 |
| Product name: | FRZB monoclonal antibody (M09), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FRZB. |
| Clone: | 4B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2487 |
| Gene name: | FRZB |
| Gene alias: | FRE|FRITZ|FRP-3|FRZB-1|FRZB-PEN|FRZB1|FZRB|SFRP3|SRFP3|hFIZ |
| Gene description: | frizzled-related protein |
| Genbank accession: | NM_001463 |
| Immunogen: | FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
| Protein accession: | NP_001454 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | FRZB monoclonal antibody (M09), clone 4B8. Western Blot analysis of FRZB expression in human spleen. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |