No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002487-M06 |
Product name: | FRZB monoclonal antibody (M06), clone 3F4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FRZB. |
Clone: | 3F4 |
Isotype: | IgG2b Kappa |
Gene id: | 2487 |
Gene name: | FRZB |
Gene alias: | FRE|FRITZ|FRP-3|FRZB-1|FRZB-PEN|FRZB1|FZRB|SFRP3|SRFP3|hFIZ |
Gene description: | frizzled-related protein |
Genbank accession: | NM_001463 |
Immunogen: | FRZB (NP_001454, 102 a.a. ~ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
Protein accession: | NP_001454 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FRZB expression in transfected 293T cell line by FRZB monoclonal antibody (M06), clone 3F4. Lane 1: FRZB transfected lysate(36.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |