| Brand: | Abnova |
| Reference: | H00002487-M02 |
| Product name: | FRZB monoclonal antibody (M02), clone 4E5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FRZB. |
| Clone: | 4E5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2487 |
| Gene name: | FRZB |
| Gene alias: | FRE|FRITZ|FRP-3|FRZB-1|FRZB-PEN|FRZB1|FZRB|SFRP3|SRFP3|hFIZ |
| Gene description: | frizzled-related protein |
| Genbank accession: | NM_001463 |
| Immunogen: | FRZB (NP_001454, 102 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
| Protein accession: | NP_001454 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FRZB monoclonal antibody (M02), clone 4E5 Western Blot analysis of FRZB expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |