View larger

FPR2 monoclonal antibody (M04), clone 2H7

Reference:

Condition: New product

Data sheet of FPR2 monoclonal antibody (M04), clone 2H7

Brand:	Abnova
Reference:	H00002358-M04
Product name:	FPR2 monoclonal antibody (M04), clone 2H7
Product description:	Mouse monoclonal antibody raised against a partial recombinant FPR2.
Clone:	2H7
Isotype:	IgG2a Kappa
Gene id:	2358
Gene name:	FPR2
Gene alias:	ALXR\|FMLP-R-II\|FMLPX\|FPR2A\|FPRH1\|FPRH2\|FPRL1\|HM63\|LXA4R
Gene description:	formyl peptide receptor 2
Genbank accession:	BC029125
Immunogen:	FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Protein accession:	AAH29125.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (30.36 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged FPR2 is approximately 10ng/ml as a capture antibody.
Applications:	WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice