| Brand: | Abnova |
| Reference: | H00002355-M01 |
| Product name: | FOSL2 monoclonal antibody (M01), clone 2B4-1C2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FOSL2. |
| Clone: | 2B4-1C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2355 |
| Gene name: | FOSL2 |
| Gene alias: | FLJ23306|FRA2 |
| Gene description: | FOS-like antigen 2 |
| Genbank accession: | BC008899 |
| Immunogen: | FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC |
| Protein accession: | AAH08899 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to FOSL2 on HeLa cell. [antibody concentration 20 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |