Cart 67 Product Products 27 010,06 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD15...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 010,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 67 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 010,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 010,06 €
Data sheet of FOS monoclonal antibody (M14), clone 2D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about FOS monoclonal antibody (M14), clone 2D11
| Brand: | Abnova |
| Reference: | H00002353-M14 |
| Product name: | FOS monoclonal antibody (M14), clone 2D11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FOS. |
| Clone: | 2D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2353 |
| Gene name: | FOS |
| Gene alias: | AP-1|C-FOS |
| Gene description: | v-fos FBJ murine osteosarcoma viral oncogene homolog |
| Genbank accession: | BC004490 |
| Immunogen: | FOS (AAH04490, 1 a.a. ~ 380 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL |
| Protein accession: | AAH04490 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (67.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between EGFR and FOS. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-FOS mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |