No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00002352-D01P |
| Product name: | FOLR3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FOLR3 protein. |
| Gene id: | 2352 |
| Gene name: | FOLR3 |
| Gene alias: | FR-G|FR-gamma|gamma-hFR |
| Gene description: | folate receptor 3 (gamma) |
| Genbank accession: | BC148785 |
| Immunogen: | FOLR3 (AAI48786.1, 1 a.a. ~ 245 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS |
| Protein accession: | AAI48786.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FOLR3 expression in transfected 293T cell line (H00002352-T01) by FOLR3 MaxPab polyclonal antibody. Lane 1: FOLR3 transfected lysate(26.95 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |