No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00002348-D01P |
Product name: | FOLR1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FOLR1 protein. |
Gene id: | 2348 |
Gene name: | FOLR1 |
Gene alias: | FBP|FOLR|FR-alpha|MOv18 |
Gene description: | folate receptor 1 (adult) |
Genbank accession: | NM_000802.2 |
Immunogen: | FOLR1 (NP_000793.1, 1 a.a. ~ 257 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
Protein accession: | NP_000793.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FOLR1 expression in transfected 293T cell line (H00002348-T03) by FOLR1 MaxPab polyclonal antibody. Lane 1: FOLR1 transfected lysate(29.80 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |