No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00002339-B02P |
Product name: | FNTA purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FNTA protein. |
Gene id: | 2339 |
Gene name: | FNTA |
Gene alias: | FPTA|MGC99680|PGGT1A|PTAR2 |
Gene description: | farnesyltransferase, CAAX box, alpha |
Genbank accession: | BC037295.2 |
Immunogen: | FNTA (AAH37295.1, 1 a.a. ~ 214 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSCTVRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQLVISFTCSFVTNMFACLPYLRHWGYSRSRSYPMELKEDRVLSGT |
Protein accession: | AAH37295.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FNTA expression in transfected 293T cell line (H00002339-T03) by FNTA MaxPab polyclonal antibody. Lane 1: FNTA transfected lysate(26.00 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |