Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FN1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr,PLA-Ce |
More info about FN1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00002335-B01P |
| Product name: | FN1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FN1 protein. |
| Gene id: | 2335 |
| Gene name: | FN1 |
| Gene alias: | CIG|DKFZp686F10164|DKFZp686H0342|DKFZp686I1370|DKFZp686O13149|ED-B|FINC|FN|FNZ|GFND|GFND2|LETS|MSF |
| Gene description: | fibronectin 1 |
| Genbank accession: | BC005858 |
| Immunogen: | FN1 (AAH05858, 1 a.a. ~ 163 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE |
| Protein accession: | AAH05858 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FN1 expression in transfected 293T cell line (H00002335-T01) by FN1 MaxPab polyclonal antibody. Lane 1: FN1 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |