Cart 40 Product Products 15 204,26 € (empty)
No products
To be determined Shipping
15 204,26 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 40 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 204,26 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 204,26 €
Data sheet of FLT3LG monoclonal antibody (M07), clone 4C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about FLT3LG monoclonal antibody (M07), clone 4C4
| Brand: | Abnova |
| Reference: | H00002323-M07 |
| Product name: | FLT3LG monoclonal antibody (M07), clone 4C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLT3LG. |
| Clone: | 4C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2323 |
| Gene name: | FLT3LG |
| Gene alias: | FL |
| Gene description: | fms-related tyrosine kinase 3 ligand |
| Genbank accession: | NM_001459 |
| Immunogen: | FLT3LG (NP_001450, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE |
| Protein accession: | NP_001450 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FLT3LG is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |