No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00002323-B01P |
| Product name: | FLT3LG purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FLT3LG protein. |
| Gene id: | 2323 |
| Gene name: | FLT3LG |
| Gene alias: | FL |
| Gene description: | fms-related tyrosine kinase 3 ligand |
| Genbank accession: | NM_001459 |
| Immunogen: | FLT3LG (NP_001450.2, 1 a.a. ~ 235 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH |
| Protein accession: | NP_001450.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of purified MaxPab antibody to FLT3LG on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |