No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00002319-M03 |
Product name: | FLOT2 monoclonal antibody (M03), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FLOT2. |
Clone: | 3G6 |
Isotype: | IgG2a Kappa |
Gene id: | 2319 |
Gene name: | FLOT2 |
Gene alias: | ECS-1|ECS1|ESA|ESA1|M17S1 |
Gene description: | flotillin 2 |
Genbank accession: | BC017292 |
Immunogen: | FLOT2 (AAH17292, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV |
Protein accession: | AAH17292 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (67.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of FLOT2 transfected lysate using anti-FLOT2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FLOT2 monoclonal antibody. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |