Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLNB polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about FLNB polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002317-A01 |
| Product name: | FLNB polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FLNB. |
| Gene id: | 2317 |
| Gene name: | FLNB |
| Gene alias: | ABP-278|AOI|DKFZp686A1668|DKFZp686O033|FH1|FLN1L|LRS1|SCT|TABP|TAP |
| Gene description: | filamin B, beta (actin binding protein 278) |
| Genbank accession: | NM_001457 |
| Immunogen: | FLNB (NP_001448, 2503 a.a. ~ 2602 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP |
| Protein accession: | NP_001448 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |