| Brand: | Abnova |
| Reference: | H00002309-M03 |
| Product name: | FOXO3A monoclonal antibody (M03), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXO3A. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2309 |
| Gene name: | FOXO3 |
| Gene alias: | AF6q21|DKFZp781A0677|FKHRL1|FKHRL1P2|FOXO2|FOXO3A|MGC12739|MGC31925 |
| Gene description: | forkhead box O3 |
| Genbank accession: | BC021224 |
| Immunogen: | FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS |
| Protein accession: | AAH21224 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |