View larger

FOXL1 monoclonal antibody (M01), clone 1F4

Reference:

Condition: New product

Data sheet of FOXL1 monoclonal antibody (M01), clone 1F4

Brand:	Abnova
Reference:	H00002300-M01
Product name:	FOXL1 monoclonal antibody (M01), clone 1F4
Product description:	Mouse monoclonal antibody raised against a partial recombinant FOXL1.
Clone:	1F4
Isotype:	IgG2a Kappa
Gene id:	2300
Gene name:	FOXL1
Gene alias:	FKH6\|FKHL11\|FREAC7
Gene description:	forkhead box L1
Genbank accession:	NM_005250
Immunogen:	FOXL1 (NP_005241.1, 221 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	AAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQ
Protein accession:	NP_005241.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.63 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged FOXL1 is approximately 0.3ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice