No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00002289-B01P |
Product name: | FKBP5 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human FKBP5 protein. |
Gene id: | 2289 |
Gene name: | FKBP5 |
Gene alias: | FKBP51|FKBP54|MGC111006|P54|PPIase|Ptg-10 |
Gene description: | FK506 binding protein 5 |
Genbank accession: | NM_004117.2 |
Immunogen: | FKBP5 (NP_004108.1, 1 a.a. ~ 457 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV |
Protein accession: | NP_004108.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | FKBP5 MaxPab polyclonal antibody. Western Blot analysis of FKBP5 expression in human placenta. |
Applications: | WB-Ti,IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | FKBP51 employs both scaffold and isomerase functions to promote NF-κB activation in melanoma.Romano S, Xiao Y, Nakaya M, D'Angelillo A, Chang M, Jin J, Hausch F, Masullo M, Feng X, Romano MF, Sun SC. Nucleic Acids Res. 2015 Jun 22. [Epub ahead of print] |