| Brand: | Abnova |
| Reference: | H00002289-B01 |
| Product name: | FKBP5 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FKBP5 protein. |
| Gene id: | 2289 |
| Gene name: | FKBP5 |
| Gene alias: | FKBP51|FKBP54|MGC111006|P54|PPIase|Ptg-10 |
| Gene description: | FK506 binding protein 5 |
| Genbank accession: | NM_004117.2 |
| Immunogen: | FKBP5 (NP_004108.1, 1 a.a. ~ 457 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV |
| Protein accession: | NP_004108.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FKBP5 MaxPab polyclonal antibody. Western Blot analysis of FKBP5 expression in human placenta. |
| Applications: | WB-Ti,IHC-P,IF,WB-Tr |
| Shipping condition: | Dry Ice |