| Brand: | Abnova |
| Reference: | H00002288-M01 |
| Product name: | FKBP4 monoclonal antibody (M01), clone 5C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FKBP4. |
| Clone: | 5C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2288 |
| Gene name: | FKBP4 |
| Gene alias: | FKBP52|FKBP59|HBI|Hsp56|PPIase|p52 |
| Gene description: | FK506 binding protein 4, 59kDa |
| Genbank accession: | BC007924 |
| Immunogen: | FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL |
| Protein accession: | AAH07924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | FKBP4 monoclonal antibody (M01), clone 5C11 Western Blot analysis of FKBP4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P Mol Cell Proteomics. 2014 Oct 2. pii: mcp.M114.041228. |