No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002281-M01 |
Product name: | FKBP1B monoclonal antibody (M01), clone 4H5-1B6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FKBP1B. |
Clone: | 4H5-1B6 |
Isotype: | IgG1 kappa |
Gene id: | 2281 |
Gene name: | FKBP1B |
Gene alias: | FKBP12.6|FKBP1L|OTK4|PKBP1L|PPIase |
Gene description: | FK506 binding protein 1B, 12.6 kDa |
Genbank accession: | BC002614 |
Immunogen: | FKBP1B (AAH02614, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC |
Protein accession: | AAH02614 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged FKBP1B is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |