Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FKBP1A monoclonal antibody (M01), clone 1E5-A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about FKBP1A monoclonal antibody (M01), clone 1E5-A12
| Brand: | Abnova |
| Reference: | H00002280-M01 |
| Product name: | FKBP1A monoclonal antibody (M01), clone 1E5-A12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FKBP1A. |
| Clone: | 1E5-A12 |
| Isotype: | IgG1 kappa |
| Gene id: | 2280 |
| Gene name: | FKBP1A |
| Gene alias: | FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE |
| Gene description: | FK506 binding protein 1A, 12kDa |
| Genbank accession: | BC005147 |
| Immunogen: | FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
| Protein accession: | AAH05147 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FKBP1A monoclonal antibody (M01), clone 1E5-A12 Western Blot analysis of FKBP1A expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Protein-protein interactions: an application of tus-ter mediated protein microarray system.Sitaraman K, Chatterjee DK. Methods Mol Biol. 2011;723:185-200. |