Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FKBP1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about FKBP1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002280-A01 |
| Product name: | FKBP1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant FKBP1A. |
| Gene id: | 2280 |
| Gene name: | FKBP1A |
| Gene alias: | FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE |
| Gene description: | FK506 binding protein 1A, 12kDa |
| Genbank accession: | BC005147 |
| Immunogen: | FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
| Protein accession: | AAH05147 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Immunophilin-loaded erythrocytes as a new delivery strategy for immunosuppressive drugs.Biagiotti S, Rossi L, Bianchi M, Giacomini E, Pierige F, Serafini G, Conaldi PG, Magnani M. J Control Release. 2011 May 27. [Epub ahead of print] |