| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00002260-M03 |
| Product name: | FGFR1 monoclonal antibody (M03), clone 5E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FGFR1. |
| Clone: | 5E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2260 |
| Gene name: | FGFR1 |
| Gene alias: | BFGFR|CD331|CEK|FGFBR|FLG|FLJ99988|FLT2|HBGFR|KAL2|N-SAM |
| Gene description: | fibroblast growth factor receptor 1 |
| Genbank accession: | BC015035 |
| Immunogen: | FGFR1 (AAH15035, 31 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMP |
| Protein accession: | AAH15035 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FGFR1 expression in transfected 293T cell line by FGFR1 monoclonal antibody (M03), clone 5E9. Lane 1: FGFR1 transfected lysate(92 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |