FGF11 (Human) Recombinant Protein (Q01) View larger

FGF11 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGF11 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about FGF11 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00002256-Q01
Product name: FGF11 (Human) Recombinant Protein (Q01)
Product description: Human FGF11 partial ORF ( NP_004103, 15 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 2256
Gene name: FGF11
Gene alias: FHF3|FLJ16061|MGC102953|MGC45269
Gene description: fibroblast growth factor 11
Genbank accession: NM_004112
Immunogen sequence/protein sequence: VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH
Protein accession: NP_004103
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00002256-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Fibroblast Growth Factor-10 Promotes Cardiomyocyte Differentiation from Embryonic and Induced Pluripotent Stem Cells.Chan SS, Li HJ, Hsueh YC, Lee DS, Chen JH, Hwang SM, Chen CY, Shih E, Hsieh PC.
PLoS One. 2010 Dec 28;5(12):e14414.

Reviews

Buy FGF11 (Human) Recombinant Protein (Q01) now

Add to cart