| Brand: | Abnova |
| Reference: | H00002256-Q01 |
| Product name: | FGF11 (Human) Recombinant Protein (Q01) |
| Product description: | Human FGF11 partial ORF ( NP_004103, 15 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 2256 |
| Gene name: | FGF11 |
| Gene alias: | FHF3|FLJ16061|MGC102953|MGC45269 |
| Gene description: | fibroblast growth factor 11 |
| Genbank accession: | NM_004112 |
| Immunogen sequence/protein sequence: | VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH |
| Protein accession: | NP_004103 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Fibroblast Growth Factor-10 Promotes Cardiomyocyte Differentiation from Embryonic and Induced Pluripotent Stem Cells.Chan SS, Li HJ, Hsueh YC, Lee DS, Chen JH, Hwang SM, Chen CY, Shih E, Hsieh PC. PLoS One. 2010 Dec 28;5(12):e14414. |