| Brand: | Abnova |
| Reference: | H00002253-M06 |
| Product name: | FGF8 monoclonal antibody (M06), clone 3H2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FGF8. |
| Clone: | 3H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2253 |
| Gene name: | FGF8 |
| Gene alias: | AIGF|HBGF-8|MGC149376 |
| Gene description: | fibroblast growth factor 8 (androgen-induced) |
| Genbank accession: | NM_033164 |
| Immunogen: | FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK |
| Protein accession: | NP_149354 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FGF8 monoclonal antibody (M06), clone 3H2 Western Blot analysis of FGF8 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |