View larger

FGF8 monoclonal antibody (M04), clone 3B10

Reference:

Condition: New product

Data sheet of FGF8 monoclonal antibody (M04), clone 3B10

Brand:	Abnova
Reference:	H00002253-M04
Product name:	FGF8 monoclonal antibody (M04), clone 3B10
Product description:	Mouse monoclonal antibody raised against a full length recombinant FGF8.
Clone:	3B10
Isotype:	IgG2a Kappa
Gene id:	2253
Gene name:	FGF8
Gene alias:	AIGF\|HBGF-8\|MGC149376
Gene description:	fibroblast growth factor 8 (androgen-induced)
Genbank accession:	NM_033164
Immunogen:	FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Protein accession:	NP_149354
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged FGF8 is approximately 1ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice