Brand: | Abnova |
Reference: | H00002253-M01 |
Product name: | FGF8 monoclonal antibody (M01), clone 2A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGF8. |
Clone: | 2A10 |
Isotype: | IgG2a Kappa |
Gene id: | 2253 |
Gene name: | FGF8 |
Gene alias: | AIGF|HBGF-8|MGC149376 |
Gene description: | fibroblast growth factor 8 (androgen-induced) |
Genbank accession: | NM_033164 |
Immunogen: | FGF8 (NP_149354, 65 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK |
Protein accession: | NP_149354 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | FGF8 monoclonal antibody (M01), clone 2A10 Western Blot analysis of FGF8 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |