No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,IP,PLA-Ce |
Brand: | Abnova |
Reference: | H00002250-M01 |
Product name: | FGF5 monoclonal antibody (M01), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FGF5. |
Clone: | 1B4 |
Isotype: | IgG1 Kappa |
Gene id: | 2250 |
Gene name: | FGF5 |
Gene alias: | HBGF-5|Smag-82 |
Gene description: | fibroblast growth factor 5 |
Genbank accession: | NM_004464 |
Immunogen: | FGF5 (NP_004455.2, 159 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG |
Protein accession: | NP_004455.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF5. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | WB-Ti,S-ELISA,ELISA,IP,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Evidence of post-transcriptional readthrough regulation in FGF5 gene of alpaca.Pallotti S, Pediconi D, Subramanian D, Molina MG, Antonini M, Morelli MB, Renieri C, La Terza A. Gene. 2018 Mar 20;647:121-128. doi: 10.1016/j.gene.2018.01.006. Epub 2018 Jan 5. |