Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF5 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about FGF5 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00002250-B01P |
| Product name: | FGF5 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FGF5 protein. |
| Gene id: | 2250 |
| Gene name: | FGF5 |
| Gene alias: | HBGF-5|Smag-82 |
| Gene description: | fibroblast growth factor 5 |
| Genbank accession: | NM_033143 |
| Immunogen: | FGF5 (NP_149134, 1 a.a. ~ 123 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR |
| Protein accession: | NP_149134 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to FGF5 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |