Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about FGF2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002247-A01 |
| Product name: | FGF2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FGF2. |
| Gene id: | 2247 |
| Gene name: | FGF2 |
| Gene alias: | BFGF|FGFB|HBGF-2 |
| Gene description: | fibroblast growth factor 2 (basic) |
| Genbank accession: | NM_002006 |
| Immunogen: | FGF2 (NP_001997, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein accession: | NP_001997 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |