Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF1 monoclonal antibody (M01), clone 3F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about FGF1 monoclonal antibody (M01), clone 3F5
| Brand: | Abnova |
| Reference: | H00002246-M01 |
| Product name: | FGF1 monoclonal antibody (M01), clone 3F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FGF1. |
| Clone: | 3F5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2246 |
| Gene name: | FGF1 |
| Gene alias: | AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1 |
| Gene description: | fibroblast growth factor 1 (acidic) |
| Genbank accession: | BC032697 |
| Immunogen: | FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Protein accession: | AAH32697 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged FGF1 is approximately 3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Acidic Fibroblast Growth Factor (FGF) Potentiates Glial-mediated Neurotoxicity by Activating FGFR2 IIIb Protein.Lee M, Kang Y, Suk K, Schwab C, Yu S, McGeer PL. J Biol Chem. 2011 Dec 2;286(48):41230-45. Epub 2011 Oct 11. |