Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about FGF1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002246-A01 |
| Product name: | FGF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FGF1. |
| Gene id: | 2246 |
| Gene name: | FGF1 |
| Gene alias: | AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1 |
| Gene description: | fibroblast growth factor 1 (acidic) |
| Genbank accession: | BC032697 |
| Immunogen: | FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Protein accession: | AAH32697 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Catabolic effects of FGF-1 on chondrocytes and its possible role in osteoarthritis.El-Seoudi A, El Kader TA, Nishida T, Eguchi T, Aoyama E, Takigawa M, Kubota S. J Cell Commun Signal. 2017 Mar 25. [Epub ahead of print] |