| Brand: | Abnova |
| Reference: | H00002244-M01 |
| Product name: | FGB monoclonal antibody (M01), clone 1D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FGB. |
| Clone: | 1D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2244 |
| Gene name: | FGB |
| Gene alias: | MGC104327|MGC120405 |
| Gene description: | fibrinogen beta chain |
| Genbank accession: | NM_005141 |
| Immunogen: | FGB (NP_005132, 392 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ |
| Protein accession: | NP_005132 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | FGB monoclonal antibody (M01), clone 1D7. Western Blot analysis of FGB expression in HepG2. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |