FDX1 monoclonal antibody (M01), clone 1E7 View larger

FDX1 monoclonal antibody (M01), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FDX1 monoclonal antibody (M01), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FDX1 monoclonal antibody (M01), clone 1E7

Brand: Abnova
Reference: H00002230-M01
Product name: FDX1 monoclonal antibody (M01), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant FDX1.
Clone: 1E7
Isotype: IgG2b Kappa
Gene id: 2230
Gene name: FDX1
Gene alias: ADX|FDX|LOH11CR1D
Gene description: ferredoxin 1
Genbank accession: NM_004109
Immunogen: FDX1 (NP_004100.1, 85 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKT
Protein accession: NP_004100.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002230-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002230-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FDX1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FDX1 monoclonal antibody (M01), clone 1E7 now

Add to cart