No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00002213-M02A |
| Product name: | FCGR2B monoclonal antibody (M02A), clone 1A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FCGR2B. |
| Clone: | 1A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2213 |
| Gene name: | FCGR2B |
| Gene alias: | CD32|CD32B|FCG2|FCGR2|IGFR2 |
| Gene description: | Fc fragment of IgG, low affinity IIb, receptor (CD32) |
| Genbank accession: | BC031992 |
| Immunogen: | FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS |
| Protein accession: | AAH31992 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | FCGR2B monoclonal antibody (M02A), clone 1A9. Western Blot analysis of FCGR2B expression in human placenta. |
| Applications: | WB-Ti,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |