Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FCGR1A monoclonal antibody (M01), clone 1D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,PLA-Ce |
More info about FCGR1A monoclonal antibody (M01), clone 1D3
| Brand: | Abnova |
| Reference: | H00002209-M01 |
| Product name: | FCGR1A monoclonal antibody (M01), clone 1D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FCGR1A. |
| Clone: | 1D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2209 |
| Gene name: | FCGR1A |
| Gene alias: | CD64|CD64A|FCRI|FLJ18345|IGFR1 |
| Gene description: | Fc fragment of IgG, high affinity Ia, receptor (CD64) |
| Genbank accession: | NM_000566 |
| Immunogen: | FCGR1A (NP_000557, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT |
| Protein accession: | NP_000557 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FCGR1A is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Selective Antibody Intervention of Toll-like Receptor 4 Activation through Fc γ Receptor Tethering.Shang L, Daubeuf B, Triantafilou M, Olden R, Depis F, Raby AC, Herren S, Dos Santos A, Malinge P, Dunn-Siegrist I, Benmkaddem S, Geinoz A, Magistrelli G, Rousseau F, Buatois V, Salgado-Pires S, Reith W, Monteiro R, Pugin J, Leger O, Ferlin W, Kosco-Vilbois M, Triantafilou K, Elson G J Biol Chem. 2014 May 30;289(22):15309-15318. Epub 2014 Apr 15. |