Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MS4A2 monoclonal antibody (M02), clone 3B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MS4A2 monoclonal antibody (M02), clone 3B1
| Brand: | Abnova |
| Reference: | H00002206-M02 |
| Product name: | MS4A2 monoclonal antibody (M02), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MS4A2. |
| Clone: | 3B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2206 |
| Gene name: | MS4A2 |
| Gene alias: | APY|ATOPY|FCER1B|FCERI|IGEL|IGER|IGHER|MS4A1 |
| Gene description: | membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide) |
| Genbank accession: | NM_000139 |
| Immunogen: | MS4A2 (NP_000130, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE |
| Protein accession: | NP_000130 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MS4A2 expression in transfected 293T cell line by MS4A2 monoclonal antibody (M02), clone 3B1. Lane 1: MS4A2 transfected lysate(26.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |