No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002197-M03 |
Product name: | FAU monoclonal antibody (M03), clone 3C10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FAU. |
Clone: | 3C10 |
Isotype: | IgG2a Kappa |
Gene id: | 2197 |
Gene name: | FAU |
Gene alias: | FAU1|FLJ22986|Fub1|Fubi|MNSFbeta|RPS30 |
Gene description: | Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed |
Genbank accession: | BC033877 |
Immunogen: | FAU (AAH33877, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS |
Protein accession: | AAH33877 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (40.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FAU expression in transfected 293T cell line by FAU monoclonal antibody (M03), clone 3C10. Lane 1: FAU transfected lysate(14.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Global Protein Conjugation by Ubiquitin-Like-Modifiers during Ischemic Stress Is Regulated by MicroRNAs and Confers Robust Tolerance to Ischemia.Lee YJ, Johnson KR, Hallenbeck JM. PLoS One. 2012;7(10):e47787. doi: 10.1371/journal.pone.0047787. Epub 2012 Oct 18. |