Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FAU monoclonal antibody (M03), clone 3C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about FAU monoclonal antibody (M03), clone 3C10
| Brand: | Abnova |
| Reference: | H00002197-M03 |
| Product name: | FAU monoclonal antibody (M03), clone 3C10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FAU. |
| Clone: | 3C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2197 |
| Gene name: | FAU |
| Gene alias: | FAU1|FLJ22986|Fub1|Fubi|MNSFbeta|RPS30 |
| Gene description: | Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed |
| Genbank accession: | BC033877 |
| Immunogen: | FAU (AAH33877, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS |
| Protein accession: | AAH33877 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FAU expression in transfected 293T cell line by FAU monoclonal antibody (M03), clone 3C10. Lane 1: FAU transfected lysate(14.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Global Protein Conjugation by Ubiquitin-Like-Modifiers during Ischemic Stress Is Regulated by MicroRNAs and Confers Robust Tolerance to Ischemia.Lee YJ, Johnson KR, Hallenbeck JM. PLoS One. 2012;7(10):e47787. doi: 10.1371/journal.pone.0047787. Epub 2012 Oct 18. |