Cart 17 Product Products 6 419,83 € (empty)
No products
To be determined Shipping
6 419,83 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 419,83 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 419,83 €
Data sheet of FAP monoclonal antibody (M01), clone 1E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about FAP monoclonal antibody (M01), clone 1E5
| Brand: | Abnova |
| Reference: | H00002191-M01 |
| Product name: | FAP monoclonal antibody (M01), clone 1E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FAP. |
| Clone: | 1E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2191 |
| Gene name: | FAP |
| Gene alias: | DKFZp686G13158|DPPIV|FAPA |
| Gene description: | fibroblast activation protein, alpha |
| Genbank accession: | BC026250 |
| Immunogen: | FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS |
| Protein accession: | AAH26250 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FAP monoclonal antibody (M01), clone 1E5 Western Blot analysis of FAP expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Fibroblast Activation Protein (FAP) Is Essential for the Migration of Bone Marrow Mesenchymal Stem Cells through RhoA Activation.Chung KM, Hsu SC, Chu YR, Lin MY, Jiaang WT, Chen RH, Chen X PLoS One. 2014 Feb 13;9(2):e88772. doi: 10.1371/journal.pone.0088772. eCollection 2014. |