Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTK2B monoclonal antibody (M01), clone 1F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about PTK2B monoclonal antibody (M01), clone 1F9
| Brand: | Abnova |
| Reference: | H00002185-M01 |
| Product name: | PTK2B monoclonal antibody (M01), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK2B. |
| Clone: | 1F9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2185 |
| Gene name: | PTK2B |
| Gene alias: | CADTK|CAKB|FADK2|FAK2|FRNK|PKB|PTK|PYK2|RAFTK |
| Gene description: | PTK2B protein tyrosine kinase 2 beta |
| Genbank accession: | BC036651 |
| Immunogen: | PTK2B (AAH36651, 682 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA |
| Protein accession: | AAH36651 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTK2B monoclonal antibody (M01), clone 1F9 Western Blot analysis of PTK2B expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |