| Brand: | Abnova |
| Reference: | H00002180-M02 |
| Product name: | ACSL1 monoclonal antibody (M02), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACSL1. |
| Clone: | 3G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2180 |
| Gene name: | ACSL1 |
| Gene alias: | ACS1|FACL1|FACL2|LACS|LACS1|LACS2 |
| Gene description: | acyl-CoA synthetase long-chain family member 1 |
| Genbank accession: | NM_001995 |
| Immunogen: | ACSL1 (NP_001986, 48 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA |
| Protein accession: | NP_001986 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ACSL1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Up-regulation of fatty acid oxidation in the ligament as a contributing factor of ankylosing spondylitis: A comparative proteomic study.Xu WD, Yang XY, Li DH, Zheng KD, Qiu PC, Zhang W, Li CY, Lei KF, Yan GQ, Jin SW, Wang JG J Proteomics. 2014 Oct 2;113C:57-72. doi: 10.1016/j.jprot.2014.09.014. |