No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002172-M01 |
Product name: | FABP6 monoclonal antibody (M01), clone 4A4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FABP6. |
Clone: | 4A4 |
Isotype: | IgG2a Kappa |
Gene id: | 2172 |
Gene name: | FABP6 |
Gene alias: | I-15P|I-BABP|I-BALB|I-BAP|ILBP|ILBP3|ILLBP |
Gene description: | fatty acid binding protein 6, ileal |
Genbank accession: | BC022489 |
Immunogen: | FABP6 (AAH22489, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
Protein accession: | AAH22489 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.82 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged FABP6 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |