| Brand: | Abnova |
| Reference: | H00002172-M01 |
| Product name: | FABP6 monoclonal antibody (M01), clone 4A4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FABP6. |
| Clone: | 4A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2172 |
| Gene name: | FABP6 |
| Gene alias: | I-15P|I-BABP|I-BALB|I-BAP|ILBP|ILBP3|ILLBP |
| Gene description: | fatty acid binding protein 6, ileal |
| Genbank accession: | BC022489 |
| Immunogen: | FABP6 (AAH22489, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
| Protein accession: | AAH22489 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.82 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FABP6 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |