Cart 18 Product Products 5 548,42 € (empty)
No products
To be determined Shipping
5 548,42 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 548,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 548,42 €
Data sheet of FABP6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FABP6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00002172-B01P |
| Product name: | FABP6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FABP6 protein. |
| Gene id: | 2172 |
| Gene name: | FABP6 |
| Gene alias: | I-15P|I-BABP|I-BALB|I-BAP|ILBP|ILBP3|ILLBP |
| Gene description: | fatty acid binding protein 6, ileal |
| Genbank accession: | BC022489 |
| Immunogen: | FABP6 (AAH22489, 1 a.a. ~ 128 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
| Protein accession: | AAH22489 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FABP6 expression in transfected 293T cell line (H00002172-T01) by FABP6 MaxPab polyclonal antibody. Lane 1: FABP6 transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |