Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FABP5 MaxPab mouse polyclonal antibody (B02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about FABP5 MaxPab mouse polyclonal antibody (B02)
| Brand: | Abnova |
| Reference: | H00002171-B02 |
| Product name: | FABP5 MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FABP5 protein. |
| Gene id: | 2171 |
| Gene name: | FABP5 |
| Gene alias: | E-FABP|EFABP|PA-FABP|PAFABP |
| Gene description: | fatty acid binding protein 5 (psoriasis-associated) |
| Genbank accession: | NM_001444 |
| Immunogen: | FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
| Protein accession: | NP_001435.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FABP5 expression in transfected 293T cell line (H00002171-T02) by FABP5 MaxPab polyclonal antibody. Lane 1: FABP5 transfected lysate(14.85 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | THE IRON-REGULATED METASTASIS SUPPRESSOR N-MYC DOWNSTREAM REGULATED GENE 1 (NDRG1) TARGETS NEDD4L, PTEN AND SMAD4 AND INHIBITS THE PI3K AND RAS SIGNALING PATHWAYS.Kovacevic Z, Chikhani S, Lui YL, Sivagurunathan S, Richardson DR. Antioxid Redox Signal. 2012 Apr 1. [Epub ahead of print] |