No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00002168-M02A |
| Product name: | FABP1 monoclonal antibody (M02A), clone 5F7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FABP1. |
| Clone: | 5F7 |
| Isotype: | IgM Kappa |
| Gene id: | 2168 |
| Gene name: | FABP1 |
| Gene alias: | FABPL|L-FABP |
| Gene description: | fatty acid binding protein 1, liver |
| Genbank accession: | BC032801 |
| Immunogen: | FABP1 (AAH32801, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Protein accession: | AAH32801 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.71 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 monoclonal antibody (M02A), clone 5F7. Lane 1: FABP1 transfected lysate(14.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |