No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00002160-M02 |
| Product name: | F11 monoclonal antibody (M02), clone 3C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant F11. |
| Clone: | 3C7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2160 |
| Gene name: | F11 |
| Gene alias: | FXI|MGC141891 |
| Gene description: | coagulation factor XI |
| Genbank accession: | NM_000128 |
| Immunogen: | F11 (NP_000119, 286 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK |
| Protein accession: | NP_000119 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |