F3 monoclonal antibody (M01A), clone 4G4 View larger

F3 monoclonal antibody (M01A), clone 4G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of F3 monoclonal antibody (M01A), clone 4G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about F3 monoclonal antibody (M01A), clone 4G4

Brand: Abnova
Reference: H00002152-M01A
Product name: F3 monoclonal antibody (M01A), clone 4G4
Product description: Mouse monoclonal antibody raised against a partial recombinant F3.
Clone: 4G4
Isotype: IgG2a Kappa
Gene id: 2152
Gene name: F3
Gene alias: CD142|TF|TFA
Gene description: coagulation factor III (thromboplastin, tissue factor)
Genbank accession: BC011029
Immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Protein accession: AAH11029
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002152-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002152-M01A-1-4-1.jpg
Application image note: F3 monoclonal antibody (M01A), clone 4G4 Western Blot analysis of F3 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.Cugno M, Marzano AV, Lorini M, Carbonelli V, Tedeschi A
PLoS One. 2014 Nov 6;9(11):e111862. doi: 10.1371/journal.pone.0111862. eCollection 2014.

Reviews

Buy F3 monoclonal antibody (M01A), clone 4G4 now

Add to cart