View larger

F3 monoclonal antibody (M01A), clone 4G4

Reference:

Condition: New product

Data sheet of F3 monoclonal antibody (M01A), clone 4G4

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	WB-Ce,ELISA,WB-Re,WB-Tr

More info about F3 monoclonal antibody (M01A), clone 4G4

Brand:	Abnova
Reference:	H00002152-M01A
Product name:	F3 monoclonal antibody (M01A), clone 4G4
Product description:	Mouse monoclonal antibody raised against a partial recombinant F3.
Clone:	4G4
Isotype:	IgG2a Kappa
Gene id:	2152
Gene name:	F3
Gene alias:	CD142\|TF\|TFA
Gene description:	coagulation factor III (thromboplastin, tissue factor)
Genbank accession:	BC011029
Immunogen:	F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Protein accession:	AAH11029
Storage buffer:	In ascites fluid
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.84 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	F3 monoclonal antibody (M01A), clone 4G4 Western Blot analysis of F3 expression in A-431 ( Cat # L015V1 ).
Applications:	WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice
Publications:	Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis.Cugno M, Marzano AV, Lorini M, Carbonelli V, Tedeschi A PLoS One. 2014 Nov 6;9(11):e111862. doi: 10.1371/journal.pone.0111862. eCollection 2014.

Reviews

Be the first to write your review !

Buy F3 monoclonal antibody (M01A), clone 4G4 now

Add to cart