No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Brand: | Abnova |
Reference: | H00002152-M01 |
Product name: | F3 monoclonal antibody (M01), clone 4G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant F3. |
Clone: | 4G4 |
Isotype: | IgG2a Kappa |
Gene id: | 2152 |
Gene name: | F3 |
Gene alias: | CD142|TF|TFA |
Gene description: | coagulation factor III (thromboplastin, tissue factor) |
Genbank accession: | BC011029 |
Immunogen: | F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK |
Protein accession: | AAH11029 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | F3 monoclonal antibody (M01), clone 4G4 Western Blot analysis of F3 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Shipping condition: | Dry Ice |