Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of F2R monoclonal antibody (M01), clone 2C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about F2R monoclonal antibody (M01), clone 2C5
| Brand: | Abnova |
| Reference: | H00002149-M01 |
| Product name: | F2R monoclonal antibody (M01), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant F2R. |
| Clone: | 2C5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2149 |
| Gene name: | F2R |
| Gene alias: | CF2R|HTR|PAR1|TR |
| Gene description: | coagulation factor II (thrombin) receptor |
| Genbank accession: | NM_001992 |
| Immunogen: | F2R (NP_001983.1, 42 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT |
| Protein accession: | NP_001983.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between MMP1 and F2R. HeLa cells were stained with anti-MMP1 rabbit purified polyclonal 1:1200 and anti-F2R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Altered Protease-Activated Receptor-1 Expression and Signaling in a Malignant Pleural Mesothelioma Cell Line, NCI-H28, with Homozygous Deletion of the β-Catenin Gene.Fazzini A PLoS One. 2014 Nov 3;9(11):e111550. doi: 10.1371/journal.pone.0111550. eCollection 2014. |